IGF2 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human IGF2 ( P01344-1, 25 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.
Sequence
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Host
Escherichia coli
Theoretical MW (kDa)
~ 7.6
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Purity
> 95% as analyzed by SDS-PAGE.
> 95% as analyzed by HPLC.Endotoxin Level
< 0.2 EU/ ug of protein (gel clotting method)
Activity
ED50 < 20.0 ng/mL, measured in a cell proliferation assay using FDCP-1 cells, corresponding to a specific activity of > 5.0 × 104 units/mg.
Recommend Usage
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Storage Instruction
Store at 4°C for 1 week. For long term storage store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing. -
Applications
Functional Study
SDS-PAGE
-
Gene Info — IGF2
Entrez GeneID
3481Protein Accession#
P01344-1Gene Name
IGF2
Gene Alias
C11orf43, FLJ22066, FLJ44734, INSIGF, pp9974
Gene Description
insulin-like growth factor 2 (somatomedin A)
Omim ID
147470Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the insulin family of polypeptide growth factors that is involved in development and growth. It is an imprinted gene and is expressed only from the paternally inherited allele. It is a candidate gene for eating disorders. There is a read-through, INS-IGF2, which aligns to this gene at the 3' region and to the upstream INS gene at the 5' region. Alternatively spliced transcript variants, encoding either the same or different isoform, have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000011012|OTTHUMP00000011015|OTTHUMP00000011018|OTTHUMP00000011157|insulin-like growth factor 2|insulin-like growth factor II|insulin-like growth factor type 2|putative insulin-like growth factor II associated protein|somatomedin A
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com