FGF8 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FGF8 (P55075, 23 a.a. - 215 a.a.) partial recombinant protein expressed in Escherichia coli.
Sequence
MQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYP
Host
Escherichia coli
Theoretical MW (kDa)
22.5
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Purity
> 95% as analyzed by SDS-PAGE.
> 95% as analyzed by HPLC.Endotoxin Level
< 0.2 EU/μg of protein by gel clotting method
Activity
ED50 < 5.0 ng/mL, measured by a cell proliferation assay using 3T3 cells in the presence of 1.0 ug/mL of heparin, corresponding to a specific activity of > 2.0 × 105 units/mg.
Recommend Usage
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from PBS. Reconstitute the lyophilized powder in ddH2O up to 100 ug/mL.
Storage Instruction
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — FGF8
Entrez GeneID
2253Protein Accession#
P55075Gene Name
FGF8
Gene Alias
AIGF, HBGF-8, MGC149376
Gene Description
fibroblast growth factor 8 (androgen-induced)
Omim ID
600483Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000020348|OTTHUMP00000020349|OTTHUMP00000020350|OTTHUMP00000020351|androgen-induced growth factor|fibroblast growth factor 8
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com