PDGFB (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PDGFB (P01127, 82 a.a. - 190 a.a.) partial recombinant protein expressed in Escherichia coli.
Sequence
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Host
Escherichia coli
Theoretical MW (kDa)
24.8
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Purity
> 97% by SDS-PAGE
Endotoxin Level
< 1 EU per 1 ug of protein (determined by LAL method)
Activity
The ED50 was determined by a cell proliferation assay using murine Balb/c 3T3 cells is < 3.0 ng/ml, corresponding to a specific activity of > 3.3 x 105 IU/mg.
Storage Buffer
Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Storage Instruction
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing. -
Applications
Functional Study
SDS-PAGE
-
Gene Info — PDGFB
Entrez GeneID
5155Protein Accession#
P01127Gene Name
PDGFB
Gene Alias
FLJ12858, PDGF2, SIS, SSV, c-sis
Gene Description
platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Omim ID
190040Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
PDGF, B chain|Platelet-derived growth factor, beta polypeptide (oncogene SIS)|becaplermin|oncogene SIS|platelet-derived growth factor 2|platelet-derived growth factor beta|platelet-derived growth factor, B chain|v-sis platelet-derived growth factor beta p
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com