Product Browser

Last updated: 2022/5/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KITLG (Human) Recombinant Protein BioActiveGMP

  • Catalog # : P7012
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human KITLG recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
  • Sequence:
  • MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 98% by SDS-PAGE
  • Endotoxin Level:
  • < 0.1 EU per 1 ug of the protein by the LAL method.
  • Activity:
  • Measure by its ability to induce TF-1 cells proliferation. The ED 50 for this effect is < 5 ng/mL. The specific activity of recombinant human SCF is > 5 x 105 IU/mg.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue

    QC Testing of P7012
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.4.
  • Storage Instruction:
  • Store at -20°C, lyophilized protein is stable for 1 year.
    After reconstitution with deionized water, store at -20 to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • Functional Study
  • Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <5 ng/mL.
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4254
  • Gene Name:
  • KITLG
  • Gene Alias:
  • DKFZp686F2250,KL-1,Kitl,MGF,SCF,SF,SHEP7
  • Gene Description:
  • KIT ligand
  • Gene Summary:
  • This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • mast cell growth factor,steel factor,stem cell factor
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook