Product Browser

Last updated: 2022/7/3

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TGFB1 (Human) Recombinant Protein BioActiveGMP

  • Catalog # : P7005
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TGFB1 recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
  • Sequence:
  • MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 98% by SDS-PAGE
  • Endotoxin Level:
  • < 0.1 EU per 1 ug of the protein by the LAL method.
  • Activity:
  • Measure by its ability to inhibit the IL-4 dependent proliferation in HT-2 cells. The ED 50 for this effect is < 0.1 ng/mL. The specific activity of recombinant human TGF beat 1 is approximately > 5 x 107 IU/mg. Measure by its ability to induce proliferation in MCF-7 cells The ED 50 for this effect is < 3.2 ng/mL.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue

    QC Testing of P7005
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS, pH 8.0.
  • Storage Instruction:
  • Store at -20°C, lyophilized protein is stable for 1 year.
    After reconstitution with deionized water, store at -20 to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • Functional Study
  • Measure by its ability to induce proliferation in MCF-7 cells The ED50 for this effect is <3.2 ng/mL.
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7040
  • Gene Name:
  • TGFB1
  • Gene Alias:
  • CED,DPD1,TGFB,TGFbeta
  • Gene Description:
  • transforming growth factor, beta 1
  • Gene Summary:
  • TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. TGFB acts synergistically with TGFA (MIM 190170) in inducing transformation. It also acts as a negative autocrine growth factor. Dysregulation of TGFB activation and signaling may result in apoptosis. Many cells synthesize TGFB and almost all of them have specific receptors for this peptide. TGFB1, TGFB2 (MIM 190220), and TGFB3 (MIM 190230) all function through the same receptor signaling systems.[supplied by OMIM
  • Other Designations:
  • TGF-beta 1 protein,diaphyseal dysplasia 1, progressive,transforming growth factor-beta 1
  • Interactome
  • Interactome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook