Product Browser

Last updated: 2022/5/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL4 (Human) Recombinant Protein BioActiveGMP

  • Catalog # : P6995
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL4 recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 98% by SDS-PAGE
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity is approximately > 2.8 x 107 IU/mg.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue

    QC Testing of P6995
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS, pH 8.0.
  • Storage Instruction:
  • Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • Functional Study
  • Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <0.2 ng/mL.
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3565
  • Gene Name:
  • IL4
  • Gene Alias:
  • BCGF-1,BCGF1,BSF1,IL-4,MGC79402
  • Gene Description:
  • interleukin 4
  • Gene Summary:
  • The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • B cell growth factor 1,B_cell stimulatory factor 1,lymphocyte stimulatory factor 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook