Product Browser

Last updated: 2022/5/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IL1B (Human) Recombinant Protein BioActiveGMP

  • Catalog # : P6992
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL1B recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA chromatography
  • Purity:
  • > 98% by SDS-PAGE
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • Measure by its ability to induce proliferation in D10.G4.1 cells. The ED50 for this effect is < 10 pg/mL. The specific activity is approximately > 1.5 x 108 IU/mg. Measure by its ability to induce IL-8 secretion in HT29 cells. The ED50 for this effect is 1.8-5.1 ng/mL.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue

    QC Testing of P6992
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS, pH 8.0.
  • Storage Instruction:
  • Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • Functional Study
  • Measure by its ability to induce IL-8 secretion in HT29 cells. The ED50 for this effect is 1.8-5.1 ng/mL.
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3553
  • Gene Name:
  • IL1B
  • Gene Alias:
  • IL-1,IL1-BETA,IL1F2
  • Gene Description:
  • interleukin 1, beta
  • Gene Summary:
  • The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq
  • Other Designations:
  • catabolin,preinterleukin 1 beta,pro-interleukin-1-beta
  • Interactome
  • Interactome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook