Product Browser

Last updated: 2021/1/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

S1 (SARS-CoV-2) Recombinant Protein 

  • Catalog # : P6673
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • SARS-CoV-2 S1 (QHD43416.1, 16 a.a. - 685 a.a.) partial recombinant protein with His tag at C-terminal expressed in HEK293 cells.
  • Sequence:
  • DGSMVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARHHHHHH
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 76.2
  • Form:
  • Liquid
  • Preparation Method:
  • Mammalian cell (HEK293) expression system
  • Purification:
  • Conventional chromatography
  • Purity:
  • > 85% by SDS-PAGE.
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method).
  • Activity:
  • Measured by its binding ability in a functional ELISA with human ACE-2.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.

    QC Testing of P6673
  • Recommend Usage:
  • Bioactivity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.4 (10% glycerol).
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of bioactivity analysis
  • S1 (SARS-CoV-2) Recombinant Protein (Cat # P6673) is coated at 5 ug/mL (100 uL/well) can bind ACE-2 in a functional ELISA assay.


  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • RSS
  • YouTube
  • Linkedin
  • Facebook