Product Browser

Last updated: 2021/1/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

S (SARS-CoV) RBD Recombinant Protein 

  • Catalog # : P6672
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • SARS-CoV S RBD (NP_828851.1, 306 a.a. - 515 a.a.) recombinant protein with His tag at C-terminal expressed in Baculovirus insect cells.
  • Sequence:
  • ADPRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLHHHHHH
  • Host:
  • Insect
  • Theoretical MW (kDa):
  • 24.7
  • Form:
  • Liquid
  • Preparation Method:
  • Baculovirus Insect cell expression system
  • Purification:
  • Conventional chromatography
  • Purity:
  • > 95% by SDS-PAGE.
  • Endotoxin Level:
  • < 1 EU per 1 ug of protein (determined by LAL method).
  • Activity:
  • Measured by its binding ability in a functional ELISA with human ACE-2.
  • Quality Control Testing:
  • 3 ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.

    QC Testing of P6672
  • Recommend Usage:
  • Bioactivity
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.4 (10% glycerol).
  • Storage Instruction:
  • Store at 2°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of bioactivity analysis

  • S (SARS-CoV) RBD Recombinant Protein (Cat # P6672) is coated at 5 ug/mL (100 uL/well) can bind ACE-2 in a functional ELISA assay.


  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • RSS
  • YouTube
  • Linkedin
  • Facebook