Product Browser

Last updated: 2020/8/9

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

N (HCoV-HKU1) Recombinant Protein Coronavirus

  • Catalog # : P6654
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • HCoV-HKU1 N (Q5MQC6, 1 a.a.- 441 a.a.) full-length recombinant protein with His tag at C-terminal expressed in Escherichia coli.
  • Sequence:
  • MSYTPGHYAGSRSSSGNRSGILKKTSWADQSERNYQTFNRGRKTQPKFTVSTQPQGNTIPHYSWFSGITQFQKGRDFKFSDGQGVPIAFGVPPSEAKGYWYRHSRRSFKTADGQQKQLLPRWYFYYLGTGPYANASYGESLEGVFWVANHQADTSTPSDVSSRDPTTQEAIPTRFPPGTILPQGYYVEGSGRSASNSRPGSRSQSRGPNNRSLSRSNSNFRHSDSIVKPDMADEIANLVLAKLGKDSKPQQVTKQNAKEIRHKILTKPRQKRTPNKHCNVQQCFGKRGPSQNFGNAEMLKLGTNDPQFPILAELAPTPGAFFFGSKLDLVKRDSEADSPVKDVFELHYSGSIRFDSTLPGFETIMKVLEENLNAYVNSNQNTDSDSLSSKPQRKRGVKQLPEQFDSLNLSAGTQHISNDFTPEDHSLLATLDDPYVEDSVA
  • Host:
  • Escherichia coli
  • Reactivity:
  • Viruses
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ni-NTA purification system
  • Purity:
  • > 98% by SDS-PAGE
  • Endotoxin Level:
  • < 0.1 EU per 1 ug as determined by the LAL method.
  • Quality Control Testing:
  • SDS-PAGE Stained with Coomassie Blue

    QC Testing of P6654
    SDS-PAGE analysis of N (HCoV-HKU1) Recombinant Protein.
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.4.
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    Aftern reconstitution with deionized water and concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved, store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Please use within one month after protein reconstitution.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • RSS
  • YouTube
  • Linkedin
  • Facebook