Product Browser

Last updated: 2021/3/7

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

S (Human coronavirus OC43) Recombinant Protein Coronavirus

  • Catalog # : P6611
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human coronavirus OC43 S (P36334, 15 a.a. - 344 a.a.) partial recombinant protein with N-terminal His tag expressed in Yeast expression system.
  • Sequence:
  • VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK
  • Host:
  • Yeast
  • Theoretical MW (kDa):
  • 39.6
  • Reactivity:
  • Viruses
  • Form:
  • Liquid
  • Preparation Method:
  • Yeast expression system
  • Purity:
  • ≥ 90% by SDS-PAGE
  • Recommend Usage:
  • SDS-PAGE
  • Storage Buffer:
  • In Tris-based buffer (50% glycerol).
  • Storage Instruction:
  • Store at -20°C or lower, liquid antibodies are stable at least 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • RSS
  • YouTube
  • Linkedin
  • Facebook