Product Browser

Last updated: 2019/12/8

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

TNFRSF12A (Human) Recombinant Protein BioActive

  • Catalog # : P6425
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF12A (Q9NP84) recombinant protein expressed in E. Coli.
  • Sequence:
  • EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 6
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Activity:
  • Determined by its ability to inhibit TWEAK-induced weak cell death of HT29 cells. The expected ED50 for this effect is 1-3 ug/mL.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Gene Name:
  • TNFRSF12A
  • Gene Alias:
  • CD266,FN14,TWEAKR
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 12A
  • Other Designations:
  • type I transmembrane protein Fn14
  • RSS
  • YouTube
  • Linkedin
  • Facebook