Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TLR4 (Human) Recombinant Protein BioActive

  • Catalog # : P6418
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TLR4 (O00206) recombinant protein expressed in CHO cells.
  • Sequence:
  • ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNKT
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 67
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Activity:
  • Determined by its ability to bind rhMD-2 in a functional ELISA.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 7099
  • Gene Name:
  • TLR4
  • Gene Alias:
  • ARMD10,CD284,TOLL,hToll
  • Gene Description:
  • toll-like receptor 4
  • Gene Summary:
  • The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta, and in myelomonocytic subpopulation of the leukocytes. It has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Also, several transcript variants of this gene have been found, but the protein coding potential of most of them is uncertain. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022807,homolog of Drosophila toll
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook