Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TMSB4X (Human) Recombinant Protein BioActive

  • Catalog # : P6414
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TMSB4X (P62328) recombinant protein expressed in E. Coli.
  • Sequence:
  • RMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 5
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Activity:
  • Measured by the protective effect against hydrogen peroxide induced cell death in primary lung fibroblasts using a concentration of 0.5-10 ug/mL.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 7114
  • Gene Name:
  • TMSB4X
  • Gene Alias:
  • FX,PTMB4,TB4X,TMSB4
  • Gene Description:
  • thymosin beta 4, X-linked
  • Gene Summary:
  • This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022925,OTTHUMP00000022926,OTTHUMP00000022927,OTTHUMP00000022928,prothymosin beta-4,thymosin beta-4,thymosin, beta 4,thymosin, beta 4, X chromosome
  • RSS
  • YouTube
  • Linkedin
  • Facebook