Product Browser

Last updated: 2019/12/1

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FAM19A2 (Human) Recombinant Protein 

  • Catalog # : P6407
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FAM19A2 (Q8N3H0) recombinant protein expressed in E. Coli.
  • Sequence:
  • ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 11
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Gene Name:
  • FAM19A2
  • Gene Alias:
  • DKFZp761E1217,DKFZp781P0552,MGC42403,TAFA-2,TAFA2
  • Gene Description:
  • family with sequence similarity 19 (chemokine (C-C motif)-like), member A2
  • Gene Summary:
  • This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook