Product Browser

Last updated: 2019/9/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RLN3 (Human) Recombinant Protein 

  • Catalog # : P6396
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RLN3 (Q8WXF3) recombinant protein expressed in E. Coli.
  • Sequence:
  • DVLAGLSSSCCKWGCSKSEISSLCRAAPYGVRLCGREFIRAVIFTCGGSRW
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 6
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Gene Name:
  • RLN3
  • Gene Alias:
  • H3,RXN3,ZINS4,insl7
  • Gene Description:
  • relaxin 3
  • Gene Summary:
  • Relaxins are known endocrine and autocrine/paracrine hormones, belonging to the insulin gene superfamily. In the human there are three non-allelic relaxin genes, RLN1, RLN2 and RLN3. RLN1 and RLN2 share high sequence homology. Relaxin is produced by the ovary, and targets the mammalian reproductive system to ripen the cervix, elongate the pubic symphysis and inhibit uterine contraction. It may have additional roles in enhancing sperm motility, regulating blood pressure, controlling heart rate and releasing oxytocin and vasopressin. The protein encoded by this gene is a member of the relaxin family. The active form of the encoded protein consists of an A chain and a B chain but their cleavage sites are not definitely described yet. It may play a role in neuropeptide signaling processes. [provided by RefSeq
  • Other Designations:
  • insulin-like 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook