Product Browser

Last updated: 2019/8/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL3L1 (Human) Recombinant Protein BioActive

  • Catalog # : P6371
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL3L1 (P16619) recombinant protein expressed in E. Coli.
  • Sequence:
  • APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Activity:
  • Determined by its ability to chemoattract human monocytes using a concentration range of 1-10 ng/mL.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 6349
  • Gene Name:
  • CCL3L1
  • Gene Alias:
  • 464.2,D17S1718,G0S19-2,LD78,LD78BETA,MGC104178,MGC12815,MGC182017,MIP1AP,SCYA3L,SCYA3L1
  • Gene Description:
  • chemokine (C-C motif) ligand 3-like 1
  • Gene Summary:
  • This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein binds to several chemokine receptors including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5). CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The copy number of this gene varies among individuals; most individuals have 1-6 copies in the diploid genome, although rare individuals have zero or more than six copies. The human genome reference assembly contains two full copies of the gene and a partial pseudogene. This record represents the more telomeric full-length gene. [provided by RefSeq
  • Other Designations:
  • small inducible cytokine A3-like 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook