Product Browser

Last updated: 2019/12/8

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Il15 (Mouse) Recombinant Protein BioActive

  • Catalog # : P6368
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Il15 (P48346) recombinant protein expressed in E. Coli.
  • Sequence:
  • MKILKPYMRNTSISCYLCFLLNSHFLTEAGIHVFILGCVSVGLPKTEANWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 13
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Activity:
  • The ED(50) was determined by the dose-dependent proliferation of murine CTLL-2 cells is < 2 ng/mL.
  • Storage Buffer:
  • Lyophilized from 0.2 um filtered PBS solution.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Gene Name:
  • Il15
  • Gene Alias:
  • AI503618
  • Gene Description:
  • interleukin 15
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook