Product Browser

Last updated: 2020/1/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MDK (Human) Recombinant Protein BioActive

  • Catalog # : P6364
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MDK (P21741) recombinant protein expressed in E. Coli.
  • Sequence:
  • VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 14
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/ug (1EU/ug).
  • Activity:
  • Determined by its ability to chemoattract human neutrophils using a concentration range of 0.1-10 ng/mL.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C on dry atmosphere in lyophilized form.
    After reconstitution with distilled water to a concentration not less than 0.1 mg/mL, this product can be stored in working aliquots at 2-8°C for one month, or at -20°C for six months, with a carrier protein without detectable loss of activity. This solution can then be diluted into other buffers.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 4192
  • Gene Name:
  • MDK
  • Gene Alias:
  • FLJ27379,MK,NEGF2
  • Gene Description:
  • midkine (neurite growth-promoting factor 2)
  • Other Designations:
  • midkine
  • RSS
  • YouTube
  • Linkedin
  • Facebook