Product Browser

Last updated: 2019/9/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GDF7 (Human) Recombinant Protein 

  • Catalog # : P6361
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GDF7 (Q7Z4P5) recombinant protein expressed in E. Coli.
  • Sequence:
  • MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 21
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Gene Name:
  • GDF7
  • Gene Alias:
  • BMP12
  • Gene Description:
  • growth differentiation factor 7
  • Gene Summary:
  • This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000115986
  • RSS
  • YouTube
  • Linkedin
  • Facebook