Product Browser

Last updated: 2022/5/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FGF19 (Human) Recombinant Protein BioActive

  • Catalog # : P6352
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF19 (O95750) recombinant protein with His tag at C-terminal expressed in E. Coli.
  • Sequence:
  • MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 23 (reduced)
  • Form:
  • Lyophilized
  • Purity:
  • > 90%, as determined by SDS-PAGE.
  • Endotoxin Level:
  • Endotoxin level was found to be less than 0.1 ng/ug (1 EU/ug). Endotoxin content was assayed using a LAL gel clot method.
  • Activity:
  • Human FGF19 activity determined by proliferation assay of mouse 3T3 cells at l ug/mL (100 uL/Well). Dose response curve for FGF19 with the EC50 of 0.1 ug/mL.
  • Storage Buffer:
  • Lyophilized from 0.2 um filtered 50 mM Tris, pH 8.
  • Storage Instruction:
  • Stored lyophilized product at -20°C.
    After reconstitution with distilled water to a concentration not less than 0.1 mg/mL, store at -20°C for 12 months or store at 2-8°C for 3 weeks.
    Aliquot to avoid repeated freezing and thawing.
    Centrifuge vial to ensure maximal product extraction, recommended: 20 sec, 5K RPM.
    For long term storage we recommend the addition of a carrier protein at 0.1%.
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 9965
  • Gene Name:
  • FGF19
  • Gene Alias:
  • -
  • Gene Description:
  • fibroblast growth factor 19
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook