Product Browser

Last updated: 2019/8/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CYR61 (Human) Recombinant Protein BioActive

  • Catalog # : P6346
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CYR61 (O00622) recombinant protein expressed in E. Coli.
  • Sequence:
  • MQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 25
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Activity:
  • Determined by its ability to inhibit IGF-II induced proliferation of MCF-7.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 3491
  • Gene Name:
  • CYR61
  • Gene Alias:
  • CCN1,GIG1,IGFBP10
  • Gene Description:
  • cysteine-rich, angiogenic inducer, 61
  • Gene Summary:
  • CYR61 is a secreted, cysteine-rich, heparin-binding protein encoded by a growth factor-inducible immediate-early gene. Acting as an extracellular, matrix-associated signaling molecule, CYR61 promotes the adhesion of endothelial cells through interaction with integrin and augments growth factor-induced DNA synthesis in the same cell type.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000012303,cysteine-rich heparin-binding protein 61,cysteine-rich, anigogenic inducer, 61
  • RSS
  • YouTube
  • Linkedin
  • Facebook