Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

CCL27 (Human) Recombinant Protein BioActive

  • Catalog # : P6344
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL27 (Q9Y4X3) recombinant protein expressed in E. Coli.
  • Sequence:
  • FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 10
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Activity:
  • Determined by its ability to chemoattract CXCR3 transfected cells using a concentration of 10-100 ng/mL.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Gene Name:
  • CCL27
  • Gene Alias:
  • ALP,CTACK,CTAK,ESKINE,ILC,PESKY,SCYA27
  • Gene Description:
  • chemokine (C-C motif) ligand 27
  • Gene Summary:
  • This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation. [provided by RefSeq
  • Other Designations:
  • CC chemokine ILC,IL-11 Ralpha-locus chemokine,OTTHUMP00000000533,OTTHUMP00000021297,cutaneous T-cell attracting chemokine,skinkine,small inducible cytokine A27,small inducible cytokine subfamily A (Cys-Cys), member 27
  • RSS
  • YouTube
  • Linkedin
  • Facebook