Product Browser

Last updated: 2019/9/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GDF6 (Human) Recombinant Protein BioActive

  • Catalog # : P6334
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GDF6 (Q6KF10) recombinant protein expressed in E. Coli.
  • Sequence:
  • TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 13
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Activity:
  • The ED50 was determined by its ability to induce alkaline phosphatase production by ATDC-5 chondrogenic cells in the range of 2-3 ug/mL.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.2.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Gene Name:
  • GDF6
  • Gene Alias:
  • BMP13,CDMP2,KFS,KFSL,MGC158100,MGC158101,SGM1
  • Gene Description:
  • growth differentiation factor 6
  • Gene Summary:
  • This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily of secreted signaling molecules. It is required for normal formation of some bones and joints in the limbs, skull, and axial skeleton. Mutations in this gene result in colobomata, which are congenital abnormalities in ocular development, and in Klippel-Feil syndrome (KFS), which is a congenital disorder of spinal segmentation. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook