Product Browser

Last updated: 2019/9/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BMP5 (Human) Recombinant Protein 

  • Catalog # : P6332
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BMP5 (P22003) recombinant protein expressed in E. Coli.
  • Sequence:
  • MHLTVFLLKGIVGFLWSCWVLVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILGLPHRPRPFSPGKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASPNGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDRSNNRFENETIKISIYQIIKEYTNRDADLFLLDTRKAQALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRQGPQSKQPFMVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 16
  • Form:
  • Lyophilized
  • Purity:
  • > 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (LAL gel clot method)
  • Storage Buffer:
  • Lyophilized from 0.2 um filtered 10 mM Sodium Citrate buffer, pH 4.0, 10% glycerol solution.
  • Storage Instruction:
  • Stored at -20°C to-80°C.
    After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Entrez GeneID:
  • 653
  • Gene Name:
  • BMP5
  • Gene Alias:
  • MGC34244
  • Gene Description:
  • bone morphogenetic protein 5
  • Gene Summary:
  • This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016650
  • RSS
  • YouTube
  • Linkedin
  • Facebook