Product Browser

Last updated: 2021/4/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GDF11 (Human/Mouse/Rat) Recombinant Protein BioActive

  • Catalog # : P6319
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human/Mouse/Rat GDF11 (O95390/Q9Z1W4/Q9Z217) recombinant protein expressed in E.Coli.
  • Sequence:
  • NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 12.5/24.9
  • Form:
  • Lyophilized
  • Purity:
  • >= 95%
  • Endotoxin Level:
  • <= 1 EUs/ug (Kinetic LAL)
  • Activity:
  • ED50 <= 100 ng/mL
    Alkaline phosphatase activity in ATDC5 cells

    The values provided above are minimum expected values to pass internal requirements.
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile 10 mM HCl at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Conformation:
  • Dimer
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Protein Accession#:
  • O95390;Q9Z1W4;Q9Z217
  • Gene Name:
  • GDF11
  • Gene Alias:
  • BMP-11,BMP11
  • Gene Description:
  • growth differentiation factor 11
  • Gene Summary:
  • The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice and Xenopus suggest that this protein is involved in mesodermal formation and neurogenesis during embryonic development. [provided by RefSeq
  • Other Designations:
  • bone morphogenetic protein 11
  • Gene Information
  • Protein Accession#:
  • O95390;Q9Z1W4;Q9Z217
  • Gene Name:
  • Gdf11
  • Gene Alias:
  • Bmp11
  • Gene Description:
  • growth differentiation factor 11
  • Other Designations:
  • -
  • Gene Information
  • Protein Accession#:
  • O95390;Q9Z1W4;Q9Z217
  • Gene Name:
  • Gdf11
  • Gene Alias:
  • -
  • Gene Description:
  • growth differentiation factor 11
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook