Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Cntf (Mouse) Recombinant Protein BioActive

  • Catalog # : P6289
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Cntf (P51642) recombinant protein expressed in E.Coli.
  • Sequence:
  • MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 22.6
  • Form:
  • Liquid
  • Purity:
  • ≥ 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (Kinetic LAL) (50% confidence)
  • Activity:
  • ED50 ≤ 50 ng/mL
    TF-1 cell proliferation

    The values provided above are minimum expected values to pass internal requirements.
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • In solution, pH 7.5 (10 mM sodium phosphate, 150 mM sodium chloride, 10 mM DTT, 50% Glycerol).
  • Storage Instruction:
  • Stored at -20°C for 12 month.
    Centrifuge vial before opening. Do not vortex.
  • Note:
  • Result of activity analysis

  • Conformation:
  • Monomer
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Gene Name:
  • Cntf
  • Gene Alias:
  • AI429687,MGC41235
  • Gene Description:
  • ciliary neurotrophic factor
  • Other Designations:
  • OTTMUSP00000029848
  • RSS
  • YouTube
  • Linkedin
  • Facebook