Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Il1a (Mouse) Recombinant Protein BioActive

  • Catalog # : P6286
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Il1a (P01582) recombinant protein expressed in E.Coli.
  • Sequence:
  • MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 18.1
  • Form:
  • Lyophilized
  • Preparation Method:
  • This product is produced with no animal or human origin raw products. All processing and handling employs animal free equipment and animal free protocols.
  • Purity:
  • ≥ 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (Kinetic LAL)
  • Activity:
  • ED50 ≤ 10 pg/mL
    D10.G4.1 proliferation

    The values provided above are minimum expected values to pass internal requirements.
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Conformation:
  • Monomer
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Gene Name:
  • Il1a
  • Gene Alias:
  • Il-1a
  • Gene Description:
  • interleukin 1 alpha
  • Other Designations:
  • OTTMUSP00000016430
  • RSS
  • YouTube
  • Linkedin
  • Facebook