Product Browser

Last updated: 2020/1/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

EBI3/IL12A (Human) Recombinant Protein 

  • Catalog # : P6254
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EBI3/IL12A (Q14213/P29459) recombinant protein expressed in HEK 293 cells.
  • Sequence:
  • EBI3: RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
    p35: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 45.8/60-65 unreduced
  • Form:
  • Lyophilized
  • Purity:
  • ≥ 95%
  • Endotoxin Level:
  • ≤ 5 EUs/ug (Kinetic LAL)
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 30 mM sodium chloride, pH7.5.
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Conformation:
  • Single chain dimer
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Protein Accession#:
  • Q14213;P29459
  • Gene Name:
  • EBI3
  • Gene Alias:
  • IL27B
  • Gene Description:
  • Epstein-Barr virus induced 3
  • Gene Summary:
  • This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq
  • Other Designations:
  • Epstein-Barr virus induced gene 3,cytokine receptor,interleukin-27 subunit beta
  • Gene Information
  • Entrez GeneID:
  • 3592
  • Protein Accession#:
  • Q14213;P29459
  • Gene Name:
  • IL12A
  • Gene Alias:
  • CLMF,IL-12A,NFSK,NKSF1,P35
  • Gene Description:
  • interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)
  • Gene Summary:
  • This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. [provided by RefSeq
  • Other Designations:
  • IL-12, subunit p35,NF cell stimulatory factor chain 1,cytotoxic lymphocyte maturation factor 1, p35,interleukin 12, p35,interleukin 12A,interleukin-12 alpha chain,natural killer cell stimulatory factor 1, 35 kD subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook