Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

THPO (Human) Recombinant Protein BioActive

  • Catalog # : P6244
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human THPO (P40225) recombinant protein expressed in CHO cells.
  • Sequence:
  • SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEGHHHHHH
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 36.3
  • Form:
  • Lyophilized
  • Purity:
  • ≥ 90%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (Kinetic LAL) (50% confidence)
  • Activity:
  • ED50 ≤ 15 ng/mL
    MO7e cell proliferation

    The values provided above are minimum expected values to pass internal requirements.
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 5 mM sodium phosphate, 140 mg L-Arginine, pH 7.5.
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Conformation:
  • Monomer
  • Applications
  • Functional Study
  • Application Image
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 7066
  • Gene Name:
  • THPO
  • Gene Alias:
  • MGC163194,MGDF,MKCSF,ML,MPLLG,TPO
  • Gene Description:
  • thrombopoietin
  • Gene Summary:
  • Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. [provided by RefSeq
  • Other Designations:
  • MPL ligand,c-mpl ligand,megakaryocyte colony-stimulating factor,megakaryocyte growth and development factor,megakaryocyte stimulating factor,myeloproliferative leukemia virus oncogene ligand,thrombopoietin nirs variant 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook