Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RSPO1 (Human) Recombinant Protein BioActive

  • Catalog # : P6237
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RSPO1 (Q2MKA7) recombinant protein expressed in CHO cells.
  • Sequence:
  • RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 25.6
  • Form:
  • Lyophilized
  • Purity:
  • ≥ 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (Kinetic LAL) (50% confidence)
  • Activity:
  • ED50 ≤ 50 ng/mL
    Luciferase induction in HEK-293 STF cells in the presence of murine Wnt-3a

    The values provided above are minimum expected values to pass internal requirements.
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing PBS.
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Conformation:
  • Monomer
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Gene Name:
  • RSPO1
  • Gene Alias:
  • CRISTIN3,FLJ40906,RSPO
  • Gene Description:
  • R-spondin homolog (Xenopus laevis)
  • Gene Summary:
  • This gene is a member of the R-spondin family and encodes a secreted activator protein with two cystein-rich, furin-like domains and one thrombospondin type 1 domain. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000180612,OTTHUMP00000180613,R-spondin1,roof plate-specific spondin
  • RSS
  • YouTube
  • Linkedin
  • Facebook