FGF5 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human FGF5 (P12034) recombinant protein expressed in E.Coli.
Sequence
MAWAHGEKRLAPKGQPGPAATDRNPIGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKNPPSPIKSKIPLSAPRKNTNSVKYRLKFRFG
Host
Escherichia coli
Theoretical MW (kDa)
27.7
Form
Lyophilized
Preparation Method
This product is produced with no animal or human origin raw products. All processing and handling employs animal free equipment and animal free protocols.
Purity
>= 95%
Endotoxin Level
<= 1 EUs/ug (Kinetic LAL)
Activity
ED50 <= 10 ng/mL
NR6R-3T3 proliferation w 1 ug heparin
The values provided above are minimum expected values to pass internal requirements.Quality Control Testing
Reducing and Non-Reducing SDS PAGE
Conformation
Monomer
Storage Buffer
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate and 100 mM sodium chloride, pH 7.5.
Storage Instruction
Stored at -20°C to-80°C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
Aliquot to avoid repeated freezing and thawing.
If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate.Note
Result of activity analysis
-
Applications
Western Blot
Functional Study
-
Gene Info — FGF5
Entrez GeneID
2250Protein Accession#
P12034Gene Name
FGF5
Gene Alias
HBGF-5, Smag-82
Gene Description
fibroblast growth factor 5
Omim ID
165190Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
heparin-binding growth factor 5
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com