WISP2 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human WISP2 (O76076) recombinant protein expressed in E.Coli.
Sequence
MQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Host
Escherichia coli
Theoretical MW (kDa)
24.4
Form
Lyophilized
Preparation Method
This product is produced with no animal or human origin raw products. All processing and handling employs animal free equipment and animal free protocols.
Purity
>= 95%
Endotoxin Level
<= 1 EUs/ug (Kinetic LAL)
Quality Control Testing
Reducing and Non-Reducing SDS PAGE
Conformation
Monomer
Storage Buffer
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Storage Instruction
Stored at -20°C to-80°C for 12 month.
After reconstitution with sterile 10 mM acetic acid at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
Aliquot to avoid repeated freezing and thawing. -
Applications
Western Blot
-
Gene Info — WISP2
Entrez GeneID
8839Protein Accession#
O76076Gene Name
WISP2
Gene Alias
CCN5, CT58, CTGF-L
Gene Description
WNT1 inducible signaling pathway protein 2
Omim ID
603399Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover. [provided by RefSeq
Other Designations
OTTHUMP00000031770|OTTHUMP00000063227|connective tissue growth factor-like protein|wnt-1 signaling pathway protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com