Product Browser

Last updated: 2021/4/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

WISP2 (Human) Recombinant Protein 

  • Catalog # : P6229
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human WISP2 (O76076) recombinant protein expressed in E.Coli.
  • Sequence:
  • MQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 24.4
  • Form:
  • Lyophilized
  • Preparation Method:
  • This product is produced with no animal or human origin raw products. All processing and handling employs animal free equipment and animal free protocols.
  • Purity:
  • >= 95%
  • Endotoxin Level:
  • <= 1 EUs/ug (Kinetic LAL)
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile 10 mM acetic acid at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Conformation:
  • Monomer
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Entrez GeneID:
  • 8839
  • Gene Name:
  • WISP2
  • Gene Alias:
  • CCN5,CT58,CTGF-L
  • Gene Description:
  • WNT1 inducible signaling pathway protein 2
  • Gene Summary:
  • This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031770,OTTHUMP00000063227,connective tissue growth factor-like protein,wnt-1 signaling pathway protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook