Product Browser

Last updated: 2022/6/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

FGF7 (Human) Recombinant Protein BioActive

  • Catalog # : P6223
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF7 (P21781) recombinant protein expressed in E.Coli.
  • Sequence:
  • MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19
  • Form:
  • Lyophilized
  • Purity:
  • >= 90%
  • Endotoxin Level:
  • <= 1 EUs/ug (Kinetic LAL)
  • Activity:
  • ED50 <= 60 ng/mL
    4MBr-5 cell proliferation

    The values provided above are minimum expected values to pass internal requirements.
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 100 mM sodium chloride, pH 7.5.
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
    If a precipitate is observed, centrifuge the solution thoroughly and use only the soluble fraction (removing it from the precipitate). A 10% overfill has been added to compensate for any loss of protein in the precipitate.
  • Note:
  • Result of activity analysis

  • Conformation:
  • Monomer
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 2252
  • Gene Name:
  • FGF7
  • Gene Alias:
  • HBGF-7,KGF
  • Gene Description:
  • fibroblast growth factor 7 (keratinocyte growth factor)
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. [provided by RefSeq
  • Other Designations:
  • fibroblast growth factor 7,heparin-binding growth factor 7,keratinocyte growth factor
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook