Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCL5 (Human) Recombinant Protein 

  • Catalog # : P6222
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CXCL5 (P42830) recombinant protein expressed in E.Coli.
  • Sequence:
  • AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8.1
  • Form:
  • Lyophilized
  • Purity:
  • ≥ 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (Kinetic LAL)
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Conformation:
  • Monomer
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Entrez GeneID:
  • 6374
  • Gene Name:
  • CXCL5
  • Gene Alias:
  • ENA-78,SCYB5
  • Gene Description:
  • chemokine (C-X-C motif) ligand 5
  • Gene Summary:
  • The protein encoded by this gene is an inflammatory chemokine that belongs to the CXC chemokine family. This chemokine is produced concomitantly with interleukin-8 (IL8) in response to stimulation with either interleukin-1 (IL1) or tumor necrosis factor-alpha (TNFA). This chemokine is a potent chemotaxin involved in neutrophil activation. [provided by RefSeq
  • Other Designations:
  • epithelial-derived neutrophil activating protein 78,epithelial-derived neutrophil-activating peptide 78,neutrophil-activating peptide ENA-78,neutrophil-activating protein 78,small inducible cytokine B5,small inducible cytokine subfamily B (Cys-X-Cys), mem
  • RSS
  • YouTube
  • Linkedin
  • Facebook