Product Browser

Last updated: 2019/8/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FGF10 (Human) Recombinant Protein BioActive

  • Catalog # : P6220
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FGF10 (O15520) recombinant protein expressed in E.Coli.
  • Sequence:
  • MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19.3
  • Form:
  • Lyophilized
  • Purity:
  • ≥ 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (Kinetic LAL)
  • Activity:
  • ED50 ≤ 200 ng/mL
    4MBr-5 cell proliferation

    The values provided above are minimum expected values to pass internal requirements.
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Conformation:
  • Monomer
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 2255
  • Gene Name:
  • FGF10
  • Gene Alias:
  • -
  • Gene Description:
  • fibroblast growth factor 10
  • Gene Summary:
  • The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing. [provided by RefSeq
  • Other Designations:
  • keratinocyte growth factor 2,produced by fibroblasts of urinary bladder lamina propria
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook