PDGFB (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Result of activity analysis
Result of activity analysis
-
Specification
Product Description
Human PDGFB (P01127) recombinant protein expressed in E.Coli.
Sequence
MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Host
Escherichia coli
Theoretical MW (kDa)
12.4/24.9
Form
Lyophilized
Purity
>= 95%
Endotoxin Level
<= 1 EUs/ug (Kinetic LAL)
Activity
ED50 <= 20 ng/mL
NR6R-3T3 cell proliferation
The values provided above are minimum expected values to pass internal requirements.Quality Control Testing
Reducing and Non-Reducing SDS PAGE
Conformation
Dimer
Storage Buffer
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Storage Instruction
Stored at -20°C to-80°C for 12 month.
After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Western Blot
Functional Study
-
Gene Info — PDGFB
Entrez GeneID
5155Protein Accession#
P01127Gene Name
PDGFB
Gene Alias
FLJ12858, PDGF2, SIS, SSV, c-sis
Gene Description
platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Omim ID
190040Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
PDGF, B chain|Platelet-derived growth factor, beta polypeptide (oncogene SIS)|becaplermin|oncogene SIS|platelet-derived growth factor 2|platelet-derived growth factor beta|platelet-derived growth factor, B chain|v-sis platelet-derived growth factor beta p
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com