Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL26 (Human) Recombinant Protein 

  • Catalog # : P6218
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL26 (Q9Y258) recombinant protein expressed in E.Coli.
  • Sequence:
  • TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8.4
  • Form:
  • Lyophilized
  • Purity:
  • ≥ 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (Kinetic LAL)
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Conformation:
  • Monomer
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Gene Name:
  • CCL26
  • Gene Alias:
  • IMAC,MGC126714,MIP-4a,MIP-4alpha,SCYA26,TSC-1
  • Gene Description:
  • chemokine (C-C motif) ligand 26
  • Gene Summary:
  • This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for normal peripheral blood eosinophils and basophils. The product of this gene is one of three related chemokines that specifically activate chemokine receptor CCR3. This chemokine may contribute to the eosinophil accumulation in atopic diseases. [provided by RefSeq
  • Other Designations:
  • CC chemokine IMAC,chemokine N1,eotaxin-3,macrophage inflammatory protein 4-alpha,small inducible cytokine A26,small inducible cytokine subfamily A (Cys-Cys), member 26,thymic stroma chemokine-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook