Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGF2 (Human) Recombinant Protein BioActive

  • Catalog # : P6212
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGF2 (P01344) recombinant protein expressed in E.Coli.
  • Sequence:
  • AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.5
  • Form:
  • Lyophilized
  • Purity:
  • ≥ 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (Kinetic LAL)
  • Activity:
  • ED50 ≤ 15 ng/mL
    Mouse FDC-P1 cell proliferation

    The values provided above are minimum expected values to pass internal requirements.
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Conformation:
  • Monomer
  • Applications
  • Western Blot
  • Functional Study
  • Application Image
  • Western Blot
  • Functional Study
  • Gene Information
  • Entrez GeneID:
  • 3481
  • Gene Name:
  • IGF2
  • Gene Alias:
  • C11orf43,FLJ22066,FLJ44734,INSIGF,pp9974
  • Gene Description:
  • insulin-like growth factor 2 (somatomedin A)
  • Gene Summary:
  • This gene encodes a member of the insulin family of polypeptide growth factors that is involved in development and growth. It is an imprinted gene and is expressed only from the paternally inherited allele. It is a candidate gene for eating disorders. There is a read-through, INS-IGF2, which aligns to this gene at the 3' region and to the upstream INS gene at the 5' region. Alternatively spliced transcript variants, encoding either the same or different isoform, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000011012,OTTHUMP00000011015,OTTHUMP00000011018,OTTHUMP00000011157,insulin-like growth factor 2,insulin-like growth factor II,insulin-like growth factor type 2,putative insulin-like growth factor II associated protein,somatomedin A
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook