Product Browser

Last updated: 2019/8/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL21 (Human) Recombinant Protein 

  • Catalog # : P6210
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL21 (O00585) recombinant protein expressed in E.Coli.
  • Sequence:
  • SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 12.3
  • Form:
  • Lyophilized
  • Purity:
  • ≥ 95%
  • Endotoxin Level:
  • ≤ 1 EUs/ug (Kinetic LAL)
  • Quality Control Testing:
  • Reducing and Non-Reducing SDS PAGE
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
  • Storage Instruction:
  • Stored at -20°C to-80°C for 12 month.
    After reconstitution with sterile water at 0.1 mg/mL, store at -20°C to -80°C for 3 months, store at 4°C for 1 month.
    Aliquot to avoid repeated freezing and thawing.
  • Conformation:
  • Monomer
  • Applications
  • Western Blot
  • Application Image
  • Western Blot
  • Gene Information
  • Entrez GeneID:
  • 6366
  • Gene Name:
  • CCL21
  • Gene Alias:
  • 6Ckine,CKb9,ECL,MGC34555,SCYA21,SLC,TCA4
  • Gene Description:
  • chemokine (C-C motif) ligand 21
  • Gene Summary:
  • This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 (CCR7) that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq
  • Other Designations:
  • Efficient Chemoattractant for Lymphocytes,OTTHUMP00000000526,OTTHUMP00000000527,OTTHUMP00000021304,beta chemokine exodus-2,exodus-2,secondary lymphoid tissue chemokine,small inducible cytokine A21,small inducible cytokine subfamily A (Cys-Cys), member 21
  • RSS
  • YouTube
  • Linkedin
  • Facebook