Product Browser

Last updated: 2018/1/14

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GLP-1 (7-37) K34R peptide

  • Catalog # : P6193
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • GLP-1 (7-37) (HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG) K34R mutant peptide with His tag expressed in Escherichia coli.
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 3.38
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • >= 90% by RP-HPLC
  • Quality Control Testing:
  • RP-HPLC, N-terminal sequencing, LC/MS/MS and SDS-PAGE
  • Storage Buffer:
  • Lyophilized from ddH2O with no additives
  • Storage Instruction:
  • Store at -20°C.
    After reconstitution with ddH2O, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 2641
  • Gene Name:
  • GCG
  • Gene Alias:
  • Gene Description:
  • glucagon
  • Gene Summary:
  • The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq
  • Other Designations:
  • glicentin-related polypeptide,glucagon-like peptide 1,glucagon-like peptide 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook