Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GZMA (Human) Recombinant Protein

  • Catalog # : P6169
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GZMA (P12544) partial recombinant protein expressed in Pichia pastoris.
  • Sequence:
  • EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
  • Host:
  • Fungi
  • Theoretical MW (kDa):
  • 31
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Preparation Method:
  • Pichia pastoris expression system
  • Recommend Usage:
  • SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3001
  • Gene Name:
  • GZMA
  • Gene Alias:
  • CTLA3,HFSP
  • Gene Description:
  • granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
  • Gene Summary:
  • Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. [provided by RefSeq
  • Other Designations:
  • CTL tryptase,Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease),granzyme A
  • RSS
  • YouTube
  • Linkedin
  • Facebook