Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL25 (Human) Recombinant proteinBioActive

  • Catalog # : P6162
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL25 (O15444) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNMQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSRKNVSLLISANSGL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 14.2
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Determined by its ability to chemoattrract human monocytes using a concentration range of 1.0-10.0 ng/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10mM Acetic Acid.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6370
  • Gene Name:
  • CCL25
  • Gene Alias:
  • Ckb15,MGC150327,SCYA25,TECK
  • Gene Description:
  • chemokine (C-C motif) ligand 25
  • Gene Summary:
  • This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. [provided by RefSeq
  • Other Designations:
  • Ck beta-15,TECKvar,chemokine TECK,small inducible cytokine A25,small inducible cytokine subfamily A (Cys-Cys), member 25,thymus expressed chemokine
  • RSS
  • YouTube
  • Linkedin
  • Facebook