Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF1B (Human) Recombinant proteinBioActive

  • Catalog # : P6159
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF1B (P20333) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSP
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 18.9
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Determined by its inhibitory effect of the TNF-α mediated cytotoxicity in murine L-929 cells. The ED50 for this effect in the presence of 0.25 ng/mL of recombinant human TNF-α, is 0.125 ug/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10 mM Sodium Phosphate (pH 8.0, 50 mM NaCl).
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7133
  • Gene Name:
  • TNFRSF1B
  • Gene Alias:
  • CD120b,TBPII,TNF-R-II,TNF-R75,TNFBR,TNFR1B,TNFR2,TNFR80,p75,p75TNFR
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 1B
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000001784,p75 TNF receptor,soluble TNFR1B variant 1,tumor necrosis factor beta receptor,tumor necrosis factor binding protein 2,tumor necrosis factor receptor 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook