Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF1A (Human) Recombinant proteinBioActive

  • Catalog # : P6158
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF1A (P19438) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 18.3
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Determined by its inhibitory effect of the TNF-α mediated cytotoxicity in murine L-929 cells. The ED50 for this effect in the presence of 0.25 ng/mL of recombinant human TNF-α, is 0.05 ug/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10 mM NaP (pH 8.0, 50 mM NaCl).
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7132
  • Gene Name:
  • TNFRSF1A
  • Gene Alias:
  • CD120a,FPF,MGC19588,TBP1,TNF-R,TNF-R-I,TNF-R55,TNFAR,TNFR1,TNFR55,TNFR60,p55,p55-R,p60
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 1A
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. [provided by RefSeq
  • Other Designations:
  • tumor necrosis factor binding protein 1,tumor necrosis factor receptor 1,tumor necrosis factor receptor type 1,tumor necrosis factor-alpha receptor
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook