Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF11A (Human) Recombinant proteinBioActive

  • Catalog # : P6157
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF11A (Q9Y6Q6) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19.3
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Determined by its ability to inhibit sRANKL induced NFkappaB in RAW264.7 cells in the absence of any cross-linking. The expected ED50 for this effect in the presence of 15 ng/mL of recombinant sRANKL, is 30-50 ng/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 10 mM Sodium Phosphate, pH 7.2.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 8792
  • Gene Name:
  • TNFRSF11A
  • Gene Alias:
  • CD265,FEO,LOH18CR1,ODFR,OFE,OPTB7,OSTS,PDB2,RANK,TRANCER
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 11a, NFKB activator
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are important regulators of the interaction between T cells and dendritic cells. This receptor is also an essential mediator for osteoclast and lymph node development. Studies of the mouse counterpart suggest that this receptor directly mediates the osteoprotegerin ligand (OPGL)-induced osteoclastogenesis in osteoclast precursor cells. [provided by RefSeq
  • Other Designations:
  • loss of heterozygosity, 18, chromosomal region 1,osteoclast differentiation factor receptor,receptor activator of nuclear factor-kappa B,tumor necrosis factor receptor superfamily, member 11a,tumor necrosis factor receptor superfamily, member 11a, activat
  • RSS
  • YouTube
  • Linkedin
  • Facebook