Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FASLG (Human) Recombinant proteinBioActive

  • Catalog # : P6150
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FASLG (P48023) patial recombinant protein with His-tag expressed in CHO cells.
  • Sequence:
  • HHHHHHHHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 17.9
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Determined by it's ability to induce cytotoxicity in Jurkat cells in the absence of any cross-linking. The ED50 for this effect is <= 10.0 ng/mL, corresponding to a specific activity of >= 1 x 105 units/mg.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 0.5x PBS, pH 7.5.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 356
  • Gene Name:
  • FASLG
  • Gene Alias:
  • APT1LG1,CD178,CD95L,FASL,TNFSF6
  • Gene Description:
  • Fas ligand (TNF superfamily, member 6)
  • Gene Summary:
  • The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). [provided by RefSeq
  • Other Designations:
  • CD95 ligand,OTTHUMP00000032708,apoptosis (APO-1) antigen ligand 1,fas ligand,tumor necrosis factor (ligand) superfamily, member 6
  • Interactome
  • Interactome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook