Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLEC11A (Human) Recombinant proteinBioActive

  • Catalog # : P6148
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CLEC11A (Q9Y240) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 25.0
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 98%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Determined by its inhibitory effect on the proliferation of TF-1 cells previously grown in media containing GM-CSF. The ED50 for this effect was observed at 7 ng/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 0.25x PBS, 1mM DTT.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 6320
  • Gene Name:
  • CLEC11A
  • Gene Alias:
  • CLECSF3,LSLCL,P47,SCGF
  • Gene Description:
  • C-type lectin domain family 11, member A
  • Gene Summary:
  • This gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. An alternative splice variant has been described but its biological nature has not been determined. [provided by RefSeq
  • Other Designations:
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 3,lymphocyte secreted long form of C-type lectin,stem cell growth factor,stem cell growth factor; lymphocyte secreted C-type lectin
  • RSS
  • YouTube
  • Linkedin
  • Facebook