Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FCER2 (Human) Recombinant proteinBioActive

  • Catalog # : P6143
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FCER2 (P06734) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19.2
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 96%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Measured by its ability to induce TNF-alpha production by human PBMCs.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from 0.5x PBS, pH 8.0.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2208
  • Gene Name:
  • FCER2
  • Gene Alias:
  • CD23,CD23A,CLEC4J,FCE2,IGEBF
  • Gene Description:
  • Fc fragment of IgE, low affinity II, receptor for (CD23)
  • Gene Summary:
  • The human leukocyte differentiation antigen CD23 (FCE2) is a key molecule for B-cell activation and growth. It is the low-affinity receptor for IgE. The truncated molecule can be secreted, then functioning as a potent mitogenic growth factor.[supplied by OMIM
  • Other Designations:
  • C-type lectin domain family 4, member J,CD23 antigen,Fc fragment of IgE, low affinity II, receptor for (CD23A)
  • RSS
  • YouTube
  • Linkedin
  • Facebook