Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PGF (Isoform 3) (Human) Recombinant proteinBioActive

  • Catalog # : P6136
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PGF (homodimer) (P49763) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 45.7
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • 95%
  • Endotoxin Level:
  • Endotoxin level is <0.1 ng/ug of protein (<1 EU/ug).
  • Activity:
  • Determined by its ability to chemoattract human monocytes using a concentration range of 5.0-50.0 ng/mL.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein.
  • Storage Instruction:
  • Store at -20°C.
    Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex.
    For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 5228
  • Gene Name:
  • PGF
  • Gene Alias:
  • D12S1900,PGFL,PLGF,PlGF-2,SHGC-10760
  • Gene Description:
  • placental growth factor
  • Other Designations:
  • placenta growth factor,placental growth factor, vascular endothelial growth factor-related protein,placental growth factor-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook